TB-500: Thymosin Beta-4 Fragment
A synthetic peptide derived from Thymosin Beta-4, studied for systemic tissue repair through actin regulation and cell migration.
Quick Reference
| Research Dosage | Loading: 4-8mg/week; Maintenance: 2-4mg/week |
|---|---|
| Frequency | 2-3 injections per week (split weekly dose) |
| Administration | Subcutaneous injection |
| Loading Phase | 4-6 weeks |
| Maintenance Phase | Ongoing as needed |
| Reconstitution | 2-3mL bacteriostatic water per 10mg vial |
| Storage | Refrigerate after reconstitution, use within 4-6 weeks |
TB-500 is a synthetic peptide corresponding to the active region of Thymosin Beta-4 (Tβ4), one of the most abundant intracellular proteins in mammalian cells. Found in exceptionally high concentrations in platelets, white blood cells, and wound fluid, Thymosin Beta-4 is released immediately following tissue damage and plays a critical role in initiating and orchestrating the repair response.
What makes TB-500 particularly interesting for tissue repair research is its unique mechanism: it regulates actin, the protein that forms the internal scaffolding of cells and enables cell movement. By controlling actin dynamics, TB-500 allows repair cells to migrate to injury sites throughout the body – a truly systemic healing effect.
Research Applications
TB-500 is studied for its systemic tissue repair and regenerative properties. Published research has demonstrated effects across multiple systems:
Musculoskeletal Tissue
TB-500's effects on connective tissue healing are extensively documented:
- Accelerated healing of muscle tears and strains with reduced fibrosis
- Tendon and ligament repair with improved structural integrity
- Improved flexibility and reduced joint stiffness
- Reduced inflammation following acute and chronic injuries
- Enhanced recovery from surgical procedures
- Protection against re-injury during healing phase
Cardiovascular System
Significant research has examined TB-500's cardiac effects:
- Blood vessel repair and new vessel formation (angiogenesis)
- Cardiac tissue regeneration following ischemic injury
- Improved blood flow to damaged areas
- Cardiomyocyte survival in stress conditions
- Post-heart attack remodelling studies
Wound Healing and Dermal Repair
- Enhanced wound closure rates
- Reduced scarring and fibrosis
- Improved tissue remodelling with better cosmetic outcomes
- Dermal repair with preserved skin architecture
- Corneal healing following injury
Hair Follicle Research
- Hair follicle stem cell migration stimulation
- Follicle enlargement and activation
- Extended growth phase (anagen) duration
- Research into pattern hair loss applications
Nervous System
- Neuroprotective effects in ischemia models
- Oligodendrocyte differentiation promotion (myelination)
- Central nervous system repair studies
- Peripheral nerve regeneration
Inflammation and Immune Modulation
- Reduced inflammatory cytokine levels
- Decreased neutrophil infiltration at injury sites
- Modulation of macrophage activity toward repair phenotypes
- Anti-inflammatory effects without immunosuppression
Dosage Information
Loading and Maintenance Protocol
Dosages commonly referenced in literature follow a biphasic loading and maintenance approach:
Loading Phase (4-6 weeks)
- Total weekly dose: 4-8mg per week
- Administration: Split into 2-3 injections (e.g., 2-2.5mg per injection)
- Purpose: Saturates tissues throughout the body with peptide
Maintenance Phase (ongoing)
- Total weekly dose: 2-4mg per week
- Administration: Split into 1-2 injections
- Purpose: Maintains tissue levels for continued effect
Why Loading is Used
TB-500's mechanism involves building up concentrations in tissues throughout the body. The loading phase achieves saturation more rapidly than starting at maintenance doses. After saturation, lower maintenance doses sustain the effect.
Administration Frequency
TB-500 has a longer biological half-life than many peptides, supporting less frequent administration. Twice-weekly injection is typical rather than the daily dosing required for shorter-acting peptides like BPC-157.
Administration Sites
TB-500 demonstrates systemic distribution regardless of injection site – the peptide circulates throughout the body and accumulates in tissues where repair is needed. Subcutaneous injection in the abdominal area is commonly utilised for convenience. Unlike BPC-157, injecting near the injury site provides no significant advantage since TB-500's mechanism is inherently systemic.
Reconstitution Guide
Required Materials
- TB-500 lyophilised powder (5mg or 10mg vial)
- Bacteriostatic water (water containing 0.9% benzyl alcohol)
- Sterile insulin syringe
- Alcohol swabs
Reconstitution Steps
- Allow the TB-500 vial to reach room temperature before reconstitution
- Draw 2-3mL of bacteriostatic water into the syringe:
- For 10mg vial: 2-3mL provides convenient dosing concentrations
- For 5mg vial: 1-2mL is typically used
- Insert the needle into the vial and direct the stream down the inside wall – do not spray directly onto the powder
- Allow the powder to dissolve naturally without shaking. TB-500 typically dissolves readily within 1-2 minutes. Gentle swirling is acceptable if needed.
- Store reconstituted solution refrigerated at 2-8°C immediately
Concentration Reference Table
| Vial Size | Water Added | Concentration | 2mg Dose | 2.5mg Dose |
|---|---|---|---|---|
| 5mg | 1mL | 5mg/mL | 40 units (0.4mL) | 50 units (0.5mL) |
| 5mg | 2.5mL | 2mg/mL | 100 units (1mL) | 125 units (1.25mL) |
| 10mg | 2mL | 5mg/mL | 40 units (0.4mL) | 50 units (0.5mL) |
| 10mg | 4mL | 2.5mg/mL | 80 units (0.8mL) | 100 units (1mL) |
Storage Guidelines
Lyophilised (Powder) Form
- Stable at room temperature for short periods (days to weeks)
- Refrigeration (2-8°C) extends stability significantly (6+ months)
- Freezing (-20°C) extends stability to 12+ months
- Protect from light and moisture
- Keep vial sealed until ready for reconstitution
Reconstituted Solution
- Must be refrigerated at 2-8°C
- Stable for 4-6 weeks when stored correctly
- Do not freeze after reconstitution
- Use sterile technique when drawing doses
- Discard if solution becomes cloudy or contains particles
TB-500 and BPC-157 Combination (Wolverine Stack)
TB-500 is most commonly studied alongside BPC-157 in what's known as the "Wolverine Stack" or "Healing Stack." The rationale for combination research is based on their fundamentally different but complementary mechanisms:
TB-500 Mechanism
- Regulates actin dynamics (cell structure and movement)
- Promotes migration of repair cells to injury sites throughout the body
- Systemic distribution – works everywhere simultaneously
- Longer biological half-life supporting less frequent dosing
- Primarily affects the "delivery" of repair cells
BPC-157 Mechanism
- Upregulates VEGFR2 and modulates nitric oxide
- Promotes angiogenesis (new blood vessel formation) at injury sites
- Strongest effects are local to the injury area
- Shorter half-life requiring more frequent dosing
- Primarily affects the "repair program" at cellular level
Why They Work Together
The combination addresses multiple phases of the healing cascade:
- TB-500 mobilises repair cells (fibroblasts, endothelial cells, stem cells) and facilitates their migration to injury sites
- BPC-157 establishes new blood supply and activates local repair mechanisms
- Together, the "delivery system" (TB-500) and "repair program" (BPC-157) work synergistically
Combination Protocols
Typical combination protocols in literature:
- BPC-157: 250-500mcg daily (subcutaneous, can be near injury)
- TB-500: 2-2.5mg twice weekly (subcutaneous, any location)
A pre-blended BPC-157 + TB-500 formulation is available for research convenience.
Frequently Asked Questions
Common questions about TB-500 research
What is the difference between TB-500 and BPC-157?
TB-500 and BPC-157 work through entirely different mechanisms. TB-500 acts through actin regulation and cell migration with strongly systemic (whole body) distribution, moving repair cells to injury sites with twice-weekly dosing due to its longer half-life. It is a synthetic version of Thymosin Beta-4 fragment. BPC-157 acts through VEGFR2/angiogenesis and growth factors with strongest local effects, activating repair processes at the cellular level with daily dosing due to its shorter half-life. It is a fragment from human gastric juice protein. The mechanisms are complementary, which is why combination research is common.
Why is it called the Wolverine Stack?
The combination of TB-500 and BPC-157 is nicknamed the "Wolverine Stack" (referencing the X-Men character known for rapid healing) due to the enhanced regenerative effects achieved through dual-pathway activation. The name reflects the combination's reputation for comprehensive tissue repair through complementary mechanisms.
Is TB-500 the same as Thymosin Beta-4?
TB-500 is a synthetic peptide fragment containing the active region of full-length Thymosin Beta-4. Specifically, TB-500 contains the LKKTETQ actin-binding domain responsible for Thymosin Beta-4's cell migration effects. Full-length Thymosin Beta-4 is a 43-amino acid protein; TB-500 focuses on the biologically active region.
What is the half-life of TB-500?
TB-500 has a relatively long biological half-life compared to many peptides, which is why twice-weekly administration is effective rather than requiring daily dosing. The exact half-life varies by measurement method, but the biological effects persist for several days following administration.
Does TB-500 require a loading phase?
Research protocols commonly utilise a loading phase (higher doses for 4-6 weeks) followed by reduced maintenance dosing. The loading approach saturates body tissues more rapidly, potentially accelerating onset of effects. After tissue saturation, lower maintenance doses sustain peptide levels.
Does injection site matter for TB-500?
Unlike BPC-157, TB-500's mechanism is inherently systemic. The peptide distributes throughout the body regardless of injection site, accumulating where repair is needed. Abdominal subcutaneous injection is commonly used for convenience – there is no significant advantage to injecting near the injury site.
Can TB-500 help with old injuries?
Research has examined TB-500 in both acute and chronic injury models. The cell migration promotion mechanism is relevant regardless of injury age. However, older injuries with established scar tissue may respond differently than acute injuries. Research protocols for chronic conditions often use extended duration approaches.
How does TB-500 affect hair growth?
TB-500 has been studied for effects on hair follicles due to its promotion of stem cell migration and tissue regeneration. Research has documented follicle enlargement, activation of dormant follicles, and extended growth phase (anagen) duration. This research area continues to develop.
The Science: How TB-500 Works
Mechanism of Action
TB-500's effects stem from its role as a key regulator of actin, one of the most abundant proteins in all cells. Understanding actin's role is essential to understanding how TB-500 works.
Actin: The Cell's Skeleton and Motor
Actin is a fundamental protein that:
- Forms the cytoskeleton – the internal scaffolding giving cells their shape
- Enables cell movement by polymerising (assembling) and depolymerising (disassembling)
- Drives muscle contraction
- Enables cell division
- Allows cells to change shape and migrate
Actin exists in two forms:
- G-actin: Monomers (single units) floating freely in the cell
- F-actin: Filaments (chains) forming structural networks
The balance between G-actin and F-actin determines how rigid or fluid the cell's structure is, and therefore how easily the cell can move.
TB-500 and Actin Regulation
TB-500 contains the LKKTETQ sequence that binds to G-actin monomers:
- Sequestration: TB-500 binds G-actin, preventing it from polymerising into F-actin filaments
- Increased Fluidity: This shifts the G-actin/F-actin balance toward more free monomers
- Enhanced Migration: With a more fluid cytoskeleton, cells can move more easily
- Directed Movement: Repair cells can migrate toward injury signals (chemotaxis)
The LKKTETQ Motif
The LKKTETQ (Lys-Lys-Thr-Glu-Thr-Gln) sequence is the key functional domain:
- This seven-amino-acid sequence is responsible for actin binding
- It's the active region that distinguishes Thymosin Beta-4 from other actin-binding proteins
- TB-500 is designed to deliver this active sequence
Cell Migration Promotion
By regulating actin, TB-500 promotes migration of multiple cell types:
Endothelial Cells:
- Enhanced migration enables angiogenesis (new blood vessel formation)
- Critical for supplying healing tissues with oxygen and nutrients
Fibroblasts:
- Migrate to wound sites to produce new connective tissue
- Synthesise collagen and extracellular matrix components
- Essential for tissue repair and scar formation
Keratinocytes:
- Skin cells migrate to close wound edges
- Important for epithelial barrier restoration
Stem/Progenitor Cells:
- Various stem cells migrate to injury sites
- Hair follicle stem cells (relevant to hair growth research)
- Cardiac progenitor cells (relevant to cardiac repair research)
Anti-Inflammatory Effects
Research indicates TB-500 has significant anti-inflammatory properties:
- Reduces pro-inflammatory cytokine levels (IL-1β, TNF-α)
- Decreases neutrophil infiltration at injury sites
- Modulates macrophage phenotype toward M2 (repair) rather than M1 (inflammatory)
- Reduces excessive inflammatory response without preventing necessary immune activity
Angiogenesis (New Blood Vessel Formation)
TB-500 promotes formation of new blood vessels through:
- Direct promotion of endothelial cell migration (as described above)
- Upregulation of angiogenic factors including VEGF
- Improved maturation and stabilisation of new vessels
- Critical for healing tissues that require new blood supply
Amino Acid Sequence and Structure
Full Thymosin Beta-4 Sequence (43 amino acids):
SDKPDMAEIEKFDKSHLKKTETQEKNPLPSKETFQSKDILQVQE
TB-500 Active Region: Contains the LKKTETQ actin-binding motif (positions 17-23 of full Thymosin Beta-4)
Key Structural Features
Actin-Binding Domain (LKKTETQ):
- Two lysines (KK) provide positive charge for actin interaction
- Threonine-Glutamate-Threonine (TET) core
- Terminal glutamine (Q)
- This sequence is necessary and sufficient for actin binding
Overall Structure:
- Relatively unstructured in solution (intrinsically disordered)
- Adopts structure upon binding to actin
- Flexible nature allows adaptation to binding partners
- Small size enables tissue penetration
Technical Specifications
| Systematic Name | Thymosin Beta-4 Fragment / TB-500 |
|---|---|
| Other Names | TB 500, TB500, Thymosin Beta-4, Thymosin Beta 4, Thymosin β4, TB4, Tβ4, Timbetasin |
| Molecular Weight | ~4,963 Da (full region) |
| CAS Number | 77591-33-4 (Thymosin Beta-4) |
| Appearance | White lyophilised powder |
| Solubility | Freely soluble in water |
| Purity (PurposeLabs) | ≥99% (HPLC verified) |
| Storage (Lyophilised) | -20°C long-term, 2-8°C short-term |
| Storage (Reconstituted) | 2-8°C, use within 4-6 weeks |
Quality: Australian University Testing
Why Peptide Quality Matters
The research peptide market contains products of highly variable quality. Independent testing of products from various suppliers has revealed significant issues:
- Purity levels as low as 50% in products claiming "99% purity"
- Incorrect amino acid sequences (entirely wrong peptides)
- Truncated sequences (missing amino acids)
- Bacterial endotoxin contamination
- Oxidised or degraded peptides with reduced activity
Our Testing Protocol
Every batch of TB-500 from PurposeLabs undergoes comprehensive testing at a leading proteomics laboratory based at an Australian university in Sydney – one of Australia's premier analytical facilities.
Confirms purity levels of ≥99%, identifies any impurities or degradation products.
Verifies exact molecular weight, confirms correct amino acid sequence.
Determines actual peptide content versus salt, moisture, and counter-ions.
Why Australian University Testing?
Our testing partner is an established, verifiable proteomics facility at a major Australian university, with published research credentials, transparent methodology, and no commercial conflict of interest. This contrasts with overseas "certificates of analysis" from unknown or unverifiable laboratories.
Shop TB-500
Australian university tested. 99%+ purity verified by HPLC and mass spectrometry. Fast shipping from Sydney.
| Product | Size | Price |
|---|
References
Key studies for researchers seeking primary literature:
- Goldstein AL, et al. "Thymosin β4: actin-sequestering protein moonlights to repair injured tissues." Trends in Molecular Medicine, 2005.
- Sosne G, et al. "Thymosin beta 4 promotes corneal wound healing and modulates inflammatory mediators in vivo." Experimental Eye Research, 2001.
- Bock-Marquette I, et al. "Thymosin β4 activates integrin-linked kinase and promotes cardiac cell migration, survival and cardiac repair." Nature, 2004.
- Philp D, et al. "Thymosin β4 increases hair growth by activation of hair follicle stem cells." FASEB Journal, 2004.
- Smart N, et al. "Thymosin β4 induces adult epicardial progenitor mobilization and neovascularization." Nature, 2007.
- Crockford D, et al. "Thymosin β4: structure, function, and biological properties supporting current and future clinical applications." Annals of the New York Academy of Sciences, 2010.
- Hinkel R, et al. "Thymosin β4 is an essential paracrine factor of embryonic endothelial progenitor cell-mediated cardioprotection." Circulation, 2008.
- Malinda KM, et al. "Thymosin β4 accelerates wound healing." Journal of Investigative Dermatology, 1999.
- Morris DC, et al. "Thymosin β4 improves functional neurological outcome in a rat model of embolic stroke." Neuroscience, 2010.
- Sosne G, et al. "Thymosin β4: a potential novel therapy for neurotrophic keratopathy, dry eye, and ocular surface diseases." Vitamins and Hormones, 2016.
Disclaimer
All products sold by PurposeLabs are intended for laboratory and research use only. They are not intended for human or animal consumption. The information provided is for educational purposes only and should not be construed as medical advice. Consult with qualified healthcare professionals for any health-related decisions.
TB-500 is not approved by the TGA for therapeutic use in Australia. Products are sold strictly for research purposes in accordance with Australian regulations.